Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMO3 Rabbit pAb (APR24445N)

Product Specifications

Background

Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-, sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression levels is likely to have significant effects on the rate at which xenobiotics are metabolised and, therefore, is of considerable interest to the pharmaceutical industry. This transmembrane protein localizes to the endoplasmic reticulum of many tissues. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Mutations in this gene cause the disorder trimethylaminuria (TMAu) which is characterized by the accumulation and excretion of unmetabolized trimethylamine and a distinctive body odor. In healthy individuals, trimethylamine is primarily converted to the non odorous trimethylamine N-oxide.

Synonyms

FMO3; FMOII; TMAU; dJ127D3.1

Gene ID

2328

UniProt

P31513

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa Observed MW: 68kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FMO3 Rabbit pAb (APR24445N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2328

Uniprot URL

https://www.uniprot.org/uniprot/P31513

AA Sequence

RFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-01 0.1 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details
FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-02 0.2 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details
FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-03 0.5 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details
FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-04 1 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details
FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-05 5 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details
FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)
MBS2056398-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Indoleamine-2, 3-Dioxygenase (IDO)

Ask
View Details