Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF17 Rabbit pAb (APR24056N)

Product Specifications

Background

This gene encodes a member of the fibroblast growth factor (FGF) family. Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is expressed during embryogenesis and in the adult cerebellum and cortex and may be essential for vascular growth and normal brain development. Mutations in this gene are the cause of hypogonadotropic hypogonadism 20 with or without anosmia. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGF17 Rabbit pAb (APR24056N) .

Synonyms

FGF17; FGF-13; FGF-17; HH20

Gene ID

8822

UniProt

O60258

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:1000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/24kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8822

Uniprot URL

https://www.uniprot.org/uniprot/O60258

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Alkaline Phosphatase Intestinal (ALPI) Rabbit anti-Human Polyclonal Antibody
GWB-632454 0.05 mL

Alkaline Phosphatase Intestinal (ALPI) Rabbit anti-Human Polyclonal Antibody

Ask
View Details
PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)
MBS6338492-01 0.2 mL

PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)

Ask
View Details
PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)
MBS6338492-02 5x 0.2 mL

PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)
MBS2067414-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)
MBS2067414-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)
MBS2067414-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP)

Ask
View Details