Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM1 Rabbit pAb (APR22571N)

Product Specifications

Background

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHRM1 Rabbit pAb (APR22571N) .

Synonyms

CHRM1; HM1; M1; M1R

Gene ID

1128

UniProt

P11229

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000 IHC 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/51kDa Observed MW: 51KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1128

Uniprot URL

https://www.uniprot.org/uniprot/P11229

AA Sequence

WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal CARHSP1 Antibody [Alexa Fluor 594]
NBP3-00026AF594 0.1 mL

Rabbit Polyclonal CARHSP1 Antibody [Alexa Fluor 594]

Ask
View Details
ZBTB48 (Zinc Finger And BTB Domain-Containing Protein 48, Krueppel-Related Zinc Finger Protein 3, Protein HKR3, Zinc Finger Protein 855, HKR3, ZNF855)
407326-01 50 µL

ZBTB48 (Zinc Finger And BTB Domain-Containing Protein 48, Krueppel-Related Zinc Finger Protein 3, Protein HKR3, Zinc Finger Protein 855, HKR3, ZNF855)

Ask
View Details
ZBTB48 (Zinc Finger And BTB Domain-Containing Protein 48, Krueppel-Related Zinc Finger Protein 3, Protein HKR3, Zinc Finger Protein 855, HKR3, ZNF855)
407326-02 100 µL

ZBTB48 (Zinc Finger And BTB Domain-Containing Protein 48, Krueppel-Related Zinc Finger Protein 3, Protein HKR3, Zinc Finger Protein 855, HKR3, ZNF855)

Ask
View Details
SELENOP Antibody, Biotin conjugated
A34386-50UG 50 µg

SELENOP Antibody, Biotin conjugated

Ask
View Details
Human RSBN1L Pre-designed siRNA Set B
SI014116B 1 Each

Human RSBN1L Pre-designed siRNA Set B

Ask
View Details
Recombinant Arabidopsis thaliana Probable disease resistance protein At5g45440 (At5g45440)
MBS1484379-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable disease resistance protein At5g45440 (At5g45440)

Ask
View Details