Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42 Rabbit pAb (APR22224N)

Product Specifications

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.

Synonyms

CDC42; CDC42Hs; G25K; TKS

Gene ID

998

UniProt

P60953

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, centrosome, cytoskeleton, microtubule organizing center, spindle

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDC42 Rabbit pAb (APR22224N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=998

Uniprot URL

https://www.uniprot.org/uniprot/P60953

AA Sequence

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
RD-NT-ProBNP-Rb-01 96 Tests

Rabbit N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Ask
View Details
Rabbit N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
RD-NT-ProBNP-Rb-02 48 Tests

Rabbit N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Ask
View Details
PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) (PE)
MBS6159597-01 0.1 mL

PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) (PE)

Ask
View Details
PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) (PE)
MBS6159597-02 5x 0.1 mL

PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) (PE)

Ask
View Details
Fam71d (NM_001017469) Rat Untagged Clone
RN213143 10 µg

Fam71d (NM_001017469) Rat Untagged Clone

Ask
View Details
KIF17 Antibody
GWB-BF71C6 0.05 mL

KIF17 Antibody

Ask
View Details