Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Y14/RBM8A Rabbit pAb (APR21675N)

Product Specifications

Background

This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome.

Synonyms

RBM8A; BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1

Gene ID

9939

UniProt

Q9Y5S9

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Y14/RBM8A Rabbit pAb (APR21675N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9939

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5S9

AA Sequence

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MMP12 Antibody
E035817 100μg/100μl

MMP12 Antibody

Ask
View Details
GUCY2F, CT (GUCY2F, GUC2F, RETGC2, Retinal guanylyl cyclase 2, Guanylate cyclase 2F, retinal, Guanylate cyclase F, Rod outer segment membrane guanylate cyclase 2) (FITC)
MBS6305122-01 0.2 mL

GUCY2F, CT (GUCY2F, GUC2F, RETGC2, Retinal guanylyl cyclase 2, Guanylate cyclase 2F, retinal, Guanylate cyclase F, Rod outer segment membrane guanylate cyclase 2) (FITC)

Ask
View Details
GUCY2F, CT (GUCY2F, GUC2F, RETGC2, Retinal guanylyl cyclase 2, Guanylate cyclase 2F, retinal, Guanylate cyclase F, Rod outer segment membrane guanylate cyclase 2) (FITC)
MBS6305122-02 5x 0.2 mL

GUCY2F, CT (GUCY2F, GUC2F, RETGC2, Retinal guanylyl cyclase 2, Guanylate cyclase 2F, retinal, Guanylate cyclase F, Rod outer segment membrane guanylate cyclase 2) (FITC)

Ask
View Details
Recombinant Synechocystis sp. UPF0093 membrane protein slr1790 (slr1790)
MBS1229123 Inquire

Recombinant Synechocystis sp. UPF0093 membrane protein slr1790 (slr1790)

Ask
View Details