Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F13A1 Rabbit pAb (APR21168N)

Product Specifications

Background

This gene encodes the coagulation factor XIII A subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.

Synonyms

F13A1; F13A

Gene ID

2162

UniProt

P00488

Cellular Locus

Cytoplasm, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 83kDa Observed MW: 83kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality F13A1 Rabbit pAb (APR21168N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2162

Uniprot URL

https://www.uniprot.org/uniprot/P00488

AA Sequence

LEQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYGELDVQIQRRPSM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HEXIM1 Antibody
A19211-50UG 50 µg

HEXIM1 Antibody

Ask
View Details
TTTY19 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48755151 3x1.0μg DNA

TTTY19 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Avian H7 Antibody ElLISA Kit
SL0019BI-01 96 Tests

Avian H7 Antibody ElLISA Kit

Ask
View Details
Avian H7 Antibody ElLISA Kit
SL0019BI-02 48 Tests

Avian H7 Antibody ElLISA Kit

Ask
View Details
Recombinant Human IFNAR2
Pr22690-01 10 µg

Recombinant Human IFNAR2

Ask
View Details
Recombinant Human IFNAR2
Pr22690-02 50 µg

Recombinant Human IFNAR2

Ask
View Details