Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICK1 Rabbit pAb (APR20156N)

Product Specifications

Background

The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA) . This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PICK1 Rabbit pAb (APR20156N) .

Synonyms

PICK1; PICK; PRKCABP

Gene ID

9463

UniProt

Q9NRD5

Cellular Locus

Cell junction, Cytoplasm, Lipid-anchor, Membrane, Peripheral membrane protein, cytoskeleton, perinuclear region, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome

Dilution

IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/46kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9463

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRD5

AA Sequence

YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 750)
MBS6486064-01 0.1 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 750)

Ask
View Details
CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 750)
MBS6486064-02 5x 0.1 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 750)

Ask
View Details
Human anti-Xip g 1 IgE
A11B88-E 1 Each

Human anti-Xip g 1 IgE

Ask
View Details
Gipc3 Mouse Pre-designed siRNA Set A
HY-RS22526 1 Set

Gipc3 Mouse Pre-designed siRNA Set A

Ask
View Details
Mouse Monoclonal SLC36A4 Antibody (PAT-4/9/H10) [DyLight 550]
NBP2-50237R 0.1 mL

Mouse Monoclonal SLC36A4 Antibody (PAT-4/9/H10) [DyLight 550]

Ask
View Details