Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin D Rabbit pAb (APR19885N)

Product Specifications

Background

This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease.

Synonyms

CLN10; CPSD; HEL-S-130P; Cathepsin D; CTSD

Gene ID

1509

UniProt

P07339

Cellular Locus

Lysosome, Melanosome, Secreted, extracellular space

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: 15kDa/28kDa/43kDa/46kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cathepsin D Rabbit pAb (APR19885N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1509

Uniprot URL

https://www.uniprot.org/uniprot/P07339

AA Sequence

GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (HRP)
MBS6250599-01 0.1 mL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (HRP)

Ask
View Details
CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (HRP)
MBS6250599-02 5x 0.1 mL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (HRP)

Ask
View Details
Agtpbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
11542114 3 x 1.0 µg

Agtpbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
CK-bio-11953-01 48 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Ask
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
CK-bio-11953-02 96 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Ask
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
CK-bio-11953-03 5x 96 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Ask
View Details