Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C Rabbit pAb (APR19884N)

Product Specifications

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein.

Synonyms

CST3; ARMD11; HEL-S-2

Gene ID

1471

UniProt

P01034

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cystatin C Rabbit pAb (APR19884N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1471

Uniprot URL

https://www.uniprot.org/uniprot/P01034

AA Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit
MBS7263309-01 48 Well

Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit

Ask
View Details
Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit
MBS7263309-02 96 Well

Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit

Ask
View Details
Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit
MBS7263309-03 5x 96 Well

Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit

Ask
View Details
Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit
MBS7263309-04 10x 96 Well

Bovine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit

Ask
View Details
BAZ1A Protein Lysate (Mouse) with C-HA Tag
13027034 100 μg

BAZ1A Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Human B7-H6 Alexa Fluor 405 Antibody (Clone 875001)
FAB7144V-100UG 100 µg

Human B7-H6 Alexa Fluor 405 Antibody (Clone 875001)

Ask
View Details