Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B6 Rabbit pAb (APR19694N)

Product Specifications

Background

This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SF3B6 Rabbit pAb (APR19694N) .

Synonyms

SF3B6; CGI-110; HSPC175; Ht006; P14; SAP14; SAP14a; SF3B14; SF3B14a

Gene ID

51639

UniProt

Q9Y3B4

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51639

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y3B4

AA Sequence

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bif (SH3GLB1) (NM_001206651) Human Tagged ORF Clone
RC232645 10 µg

Bif (SH3GLB1) (NM_001206651) Human Tagged ORF Clone

Ask
View Details
Bax (Apoptosis Regulator BAX, Apoptosis Regulator BAX Cytoplasmic Isoform beta, Apoptosis Regulator BAX Membrane Isoform alpha, BAX, Bax Isoform psi, BAX Protein Cytoplasmic Isoform delta, Bax Protein Cytoplasmic Isoform delta, Bax Protein Cytoplasmic Isoform gamma, Bax zeta, Bax-Protein, BAX_HUMAN, BAXA, Bcl-2-like Protein 4, BCL2 Associated X Protein, BCL2 Associated X Protein omega, BCL2 Associated X Protein Transcript Variant delta2, Bcl2-L-4, BCL2L4, Membrane Isoform alpha)
381575 100 µL

Bax (Apoptosis Regulator BAX, Apoptosis Regulator BAX Cytoplasmic Isoform beta, Apoptosis Regulator BAX Membrane Isoform alpha, BAX, Bax Isoform psi, BAX Protein Cytoplasmic Isoform delta, Bax Protein Cytoplasmic Isoform delta, Bax Protein Cytoplasmic Isoform gamma, Bax zeta, Bax-Protein, BAX_HUMAN, BAXA, Bcl-2-like Protein 4, BCL2 Associated X Protein, BCL2 Associated X Protein omega, BCL2 Associated X Protein Transcript Variant delta2, Bcl2-L-4, BCL2L4, Membrane Isoform alpha)

Ask
View Details
GMCSF (CSF2, Granulocyte-macrophage Colony-stimulating Factor, GM-CSF, Colony-stimulating Factor, CSF, Molgramostin, Sargramostim) (MaxLight 490)
127394-ML490 100 µL

GMCSF (CSF2, Granulocyte-macrophage Colony-stimulating Factor, GM-CSF, Colony-stimulating Factor, CSF, Molgramostin, Sargramostim) (MaxLight 490)

Ask
View Details
Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit
MBS1607171-01 48 Well

Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit

Ask
View Details
Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit
MBS1607171-02 96 Well

Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit

Ask
View Details
Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit
MBS1607171-03 5x 96 Well

Human Tripartite motif-containing protein 72, TRIM72 ELISA Kit

Ask
View Details