Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mitofusin 2 Rabbit pAb (APR19388N)

Product Specifications

Background

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.

Synonyms

CMT2A; CMT2A2; CMT2A2A; CMT2A2B; CPRP1; HMSN6A; HSG; MARF; MFN2; Mitofusin 2

Gene ID

9927

UniProt

O95140

Cellular Locus

Mitochondrion outer membrane, Multi-pass membrane protein

Applications

WB (Human bone marrow cancer cell, Rattus norvegicus, Homo sapiens, Mus musculus) IHC (Human bone marrow cancer cell)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/86kDa Observed MW: 86KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Mitofusin 2 Rabbit pAb (APR19386N1) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9927

Uniprot URL

https://www.uniprot.org/uniprot/O95140

AA Sequence

GLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPKNSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PLCH2 Protein Lysate
MBS8417332-01 0.02 mg

Human PLCH2 Protein Lysate

Ask
View Details
Human PLCH2 Protein Lysate
MBS8417332-02 5x 0.02 mg

Human PLCH2 Protein Lysate

Ask
View Details
Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)
MBS1424094-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)

Ask
View Details
Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)
MBS1424094-02 0.02 mg (Yeast)

Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)

Ask
View Details
Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)
MBS1424094-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)

Ask
View Details
Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)
MBS1424094-04 0.1 mg (Yeast)

Recombinant Xenopus laevis Protein kinase C and casein kinase substrate in neurons protein 2 (pacsin2)

Ask
View Details