Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEB1 Rabbit pAb (APR19143N)

Product Specifications

Background

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCEB1 Rabbit pAb (APR19143N) .

Synonyms

ELOC; SIII; TCEB1; eloC; elongin-C

Gene ID

6921

UniProt

Q15369

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6921

Uniprot URL

https://www.uniprot.org/uniprot/Q15369

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sentrin 1 (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, Ubiquitin-like Protein SMT3C, Ubiquitin-like Protein UBL1, UBL1) (Not for Export EU)
S0750-01G2 100 µL

Sentrin 1 (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, Ubiquitin-like Protein SMT3C, Ubiquitin-like Protein UBL1, UBL1) (Not for Export EU)

Ask
View Details
HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (MaxLight 490)
128156-ML490 100 µL

HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (MaxLight 490)

Ask
View Details
Recombinant Drosophila simulans Protein crossbronx (cbx)
MBS1183193-01 0.02 mg (E-Coli)

Recombinant Drosophila simulans Protein crossbronx (cbx)

Ask
View Details
Recombinant Drosophila simulans Protein crossbronx (cbx)
MBS1183193-02 0.1 mg (E-Coli)

Recombinant Drosophila simulans Protein crossbronx (cbx)

Ask
View Details
Recombinant Drosophila simulans Protein crossbronx (cbx)
MBS1183193-03 0.02 mg (Yeast)

Recombinant Drosophila simulans Protein crossbronx (cbx)

Ask
View Details
Recombinant Drosophila simulans Protein crossbronx (cbx)
MBS1183193-04 0.1 mg (Yeast)

Recombinant Drosophila simulans Protein crossbronx (cbx)

Ask
View Details