Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DOB Rabbit pAb (APR18831N)

Product Specifications

Background

HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.

Synonyms

HLA-DOB; DOB; HLA_DOB; major histocompatibility complex; class II; DO beta

Gene ID

3112

UniProt

P13765

Cellular Locus

Endosome membrane, Lysosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa Observed MW: 31kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DOB Rabbit pAb (APR18831N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3112

Uniprot URL

https://www.uniprot.org/uniprot/P13765

AA Sequence

TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EPCAM (NM_002354) Human Tagged ORF Clone Lentiviral Particle
RC201989L4V 200 µL

EPCAM (NM_002354) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Vmn1r128 Mouse Gene Knockout Kit (CRISPR)
KN518930 1 Kit

Vmn1r128 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Recombinant Mouse Adiponectin/ACRP30 Protein, C-His
EMH22001 100 μg

Recombinant Mouse Adiponectin/ACRP30 Protein, C-His

Ask
View Details
Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)
MBS2101464-01 5x 96 Tests

Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)

Ask
View Details
Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)
MBS2101464-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)

Ask
View Details
Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)
MBS2101464-03 10x 96 Tests

Human Inhibitory Subunit Of NF Kappa B Zeta (IkBz) Antibody Pair Kit (with Standard)

Ask
View Details