Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQSTM1/p62 Rabbit pAb (APR18387N)

Product Specifications

Background

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.

Synonyms

SQSTM1; A170; DMRV; FTDALS3; NADGP; OSIL; PDB3; ZIP3; p60; p62; p62B

Gene ID

8878

UniProt

Q13501

Cellular Locus

Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa/47kDa Observed MW: 62kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SQSTM1/p62 Rabbit pAb (APR18384N7) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8878

Uniprot URL

https://www.uniprot.org/uniprot/Q13501

AA Sequence

MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NSD3/WHSC1L1 Rabbit pAb
E45R25928N 50 ul

NSD3/WHSC1L1 Rabbit pAb

Ask
View Details
PDZ1P rabbit pAb
E44H15139 100ul

PDZ1P rabbit pAb

Ask
View Details
Mouse EN2 siRNA
abx915385-01 15 nmol

Mouse EN2 siRNA

Ask
View Details
Mouse EN2 siRNA
abx915385-02 30 nmol

Mouse EN2 siRNA

Ask
View Details
Integrin alpha 9 beta 1 (Integrin alpha 9, ITGA9, Integrin beta 1, ITGB1, Alpha-RLC, CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, Integrin alpha-RLC, ITGA4L, MDF2, MSK12, RLC, VLA-4 Subunit beta, VLA-beta, VLAB) (MaxLight 550)
MBS6255041-01 0.1 mL

Integrin alpha 9 beta 1 (Integrin alpha 9, ITGA9, Integrin beta 1, ITGB1, Alpha-RLC, CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, Integrin alpha-RLC, ITGA4L, MDF2, MSK12, RLC, VLA-4 Subunit beta, VLA-beta, VLAB) (MaxLight 550)

Ask
View Details
Integrin alpha 9 beta 1 (Integrin alpha 9, ITGA9, Integrin beta 1, ITGB1, Alpha-RLC, CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, Integrin alpha-RLC, ITGA4L, MDF2, MSK12, RLC, VLA-4 Subunit beta, VLA-beta, VLAB) (MaxLight 550)
MBS6255041-02 5x 0.1 mL

Integrin alpha 9 beta 1 (Integrin alpha 9, ITGA9, Integrin beta 1, ITGB1, Alpha-RLC, CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, Integrin alpha-RLC, ITGA4L, MDF2, MSK12, RLC, VLA-4 Subunit beta, VLA-beta, VLAB) (MaxLight 550)

Ask
View Details