Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTEN Rabbit pAb (APR18369N)

Product Specifications

Background

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. The use of a non-canonical (CUG) upstream initiation site produces a longer isoform that initiates translation with a leucine, and is thought to be preferentially associated with the mitochondrial inner membrane. This longer isoform may help regulate energy metabolism in the mitochondria. A pseudogene of this gene is found on chromosome 9. Alternative splicing and the use of multiple translation start codons results in multiple transcript variants encoding different isoforms.

Synonyms

10q23del; BZS; CWS1; DEC; GLM2; MHAM; MMAC1; PTEN1; TEP1; PTEN; PTENbeta

Gene ID

5728

UniProt

P60484

Cellular Locus

Cytoplasm, Nucleus, PML body, Secreted

Dilution

WB 1:500 - 1:2000IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/47kDa/64kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTEN Rabbit pAb (APR18369N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5728

Uniprot URL

https://www.uniprot.org/uniprot/P60484

AA Sequence

IYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

JMJD2D Peptide - C-terminal region (AAP35946)
AAP35946-100UG 100 µg

JMJD2D Peptide - C-terminal region (AAP35946)

Ask
View Details
Rabbit Polyclonal Ets-1 Antibody
NBP2-56897 100 µL

Rabbit Polyclonal Ets-1 Antibody

Ask
View Details
C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) Magnetic Luminex Assay Kit
LKU603510 96 Tests

C1q And Tumor Necrosis Factor Related Protein 3 (C1QTNF3) Magnetic Luminex Assay Kit

Ask
View Details
ZNF726 ORF Vector (Human) (pORF)
51773011 1.0 µg DNA

ZNF726 ORF Vector (Human) (pORF)

Ask
View Details
Mouse Monoclonal Kallikrein 3/PSA Antibody (rKLK3/6947) [Alexa Fluor 488]
NBP3-20702AF488 0.1 mL

Mouse Monoclonal Kallikrein 3/PSA Antibody (rKLK3/6947) [Alexa Fluor 488]

Ask
View Details