Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17RA Rabbit pAb (APR17687N)

Product Specifications

Background

Interleukin 17A (IL17A) is a proinflammatory cytokine secreted by activated T-lymphocytes. It is a potent inducer of the maturation of CD34-positive hematopoietic precursors into neutrophils. The transmembrane protein encoded by this gene (interleukin 17A receptor; IL17RA) is a ubiquitous type I membrane glycoprotein that binds with low affinity to interleukin 17A. Interleukin 17A and its receptor play a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. Like other cytokine receptors, this receptor likely has a multimeric structure. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL17RA Rabbit pAb (APR17687N) .

Synonyms

IL17RA; CANDF5; CD217; CDw217; IL-17RA; IL17R; IMD51; hIL-17R

Gene ID

23765

UniProt

Q96F46

Cellular Locus

Membrane, Secreted, Single-pass type I membrane protein

Applications

WB (Rattus norvegicus)

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 92kDa/96kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23765

Uniprot URL

https://www.uniprot.org/uniprot/Q96F46

AA Sequence

AGEGEACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Klrb1 shRNA (UAS) - Lentiviral mouse Klrb1 shRNA (UAS, iRFP) plasmid
GTR15133072 1 Vial

Lentiviral mouse Klrb1 shRNA (UAS) - Lentiviral mouse Klrb1 shRNA (UAS, iRFP) plasmid

Ask
View Details
SUMO2, SUMO3, NT (K5) (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 405) discontinued
S8026-01F-ML405 100 µL

SUMO2, SUMO3, NT (K5) (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 405) discontinued

Ask
View Details
Mouse ECF/CCL11 (Eosinophil Chemotactic Factor) QuickTest ELISA Kit
QT-EM0996 96 Tests

Mouse ECF/CCL11 (Eosinophil Chemotactic Factor) QuickTest ELISA Kit

Ask
View Details
Frozen Tissue Sections, Colon
CS529650 5x 5 µm

Frozen Tissue Sections, Colon

Ask
View Details
3- (4-Hydroxyphenyl) propionic acid hydrazide
280002-01 25 mg

3- (4-Hydroxyphenyl) propionic acid hydrazide

Ask
View Details
3- (4-Hydroxyphenyl) propionic acid hydrazide
280002-02 50 mg

3- (4-Hydroxyphenyl) propionic acid hydrazide

Ask
View Details