Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA70/RPA1 Rabbit pAb (APR17572N)

Product Specifications

Background

As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism (PubMed:27723720, PubMed:27723717) . In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response (PubMed:24332808) . It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage (PubMed:17765923) . Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair (PubMed:7697716) . Plays also a role in base excision repair (BER) probably through interaction with UNG (PubMed:9765279) . Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance (PubMed:17959650) . The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA synthesis by polymerase delta in presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.

Synonyms

RPA1; HSSB; MST075; REPA1; RF-A; RP-A; RPA70

Gene ID

6117

UniProt

P27694

Cellular Locus

Nucleus, PML body

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 68kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPA70/RPA1 Rabbit pAb (APR17572N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6117

Uniprot URL

https://www.uniprot.org/uniprot/P27694

AA Sequence

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)
MBS8422652-01 0.12 mL

Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)

Ask
View Details
Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)
MBS8422652-02 0.2 mL

Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)

Ask
View Details
Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)
MBS8422652-03 5x 0.2 mL

Rabbit Anti Human Na+/K+-ATPase alpha1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4)(Western Blot)

Ask
View Details
DDB1 Goat Polyclonal Antibody
TA302707 100 µg

DDB1 Goat Polyclonal Antibody

Ask
View Details
C1ql1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
14245114 3 x 1.0 µg

C1ql1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
DNA-directed RNA polymerase I subunit RPA12 (ZNRD1) Rat ELISA Kit
C9596 96 Tests

DNA-directed RNA polymerase I subunit RPA12 (ZNRD1) Rat ELISA Kit

Ask
View Details