Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CDKN2A/p16INK4a Rabbit pAb (APR17377N)

Product Specifications

Background

This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.

Synonyms

CDKN2A; ARF; CDK4I; CDKN2; CMM2; INK4; INK4A; MLM; MTS-1; MTS1; P14; P14ARF; P16; P16-INK4A; P16INK4; P16INK4A; P19; P19ARF; TP16

Gene ID

1029

UniProt

P42771/Q8N726

Cellular Locus

Cytoplasm, Nucleus

Applications

IF (Mus musculus) WB (Mus musculus, Homo sapiens, Rattus norvegicus) IHC (Mus musculus) ICC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/11kDa/12kDa/13kDa/16kDa/17kDa Observed MW: 17KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CDKN2A/p16INK4a Rabbit pAb (APR17377N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1029

Uniprot URL

https://www.uniprot.org/uniprot/P42771/Q8N726

AA Sequence

NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)
MBS1376263-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAB1567 (SAB1567)

Ask
View Details