Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse anti GST-Tag mAb (AMM22045N)

Product Specifications

Background

Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.

Synonyms

GST; GST tag; GST-tag

Applications

WB (Nicotiana benthamiana, Homo sapiens, Arabidopsis thaliana, Other, Mus musculus, Oryza sativa, Yeast, Ctenopharyngodon idellus, Gallus gallus) IP (Mus musculus, Other, Ctenopharyngodon idellus) Co-IP (Ctenopharyngodon idellus, Other) ELISA (Mus musculus, Rattus norvegicus, Oyster) IF (Mus musculus, Rattus norvegicus, Oyster)

Dilution

WB 1:2000 - 1:5000 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Mouse anti GST-Tag mAb (AMM22045N) .

AA Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-36Ra Recombinant Protein
90-280 10 µg

IL-36Ra Recombinant Protein

Ask
View Details
γ2-Syntrophin (h)-PR
sc-43443-PR 10 µM, 20 µL

γ2-Syntrophin (h)-PR

Ask
View Details
Washc1 (NM_026833) Mouse Recombinant Protein
PM46141M5 20 µg

Washc1 (NM_026833) Mouse Recombinant Protein

Ask
View Details
Rabbit Polyclonal MORC3 Antibody [Janelia Fluor 646]
NBP3-06255JF646 0.1 mL

Rabbit Polyclonal MORC3 Antibody [Janelia Fluor 646]

Ask
View Details
BSA Conjugated Phosphatidylserine (PS)
MBS2086488-01 0.01 mg

BSA Conjugated Phosphatidylserine (PS)

Ask
View Details
BSA Conjugated Phosphatidylserine (PS)
MBS2086488-02 0.05 mg

BSA Conjugated Phosphatidylserine (PS)

Ask
View Details