Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT1 Antibody - C-terminal region : FITC (ARP76190_P050-FITC)

Product Specifications

Gene Name

Beta-1,4-galactosyltransferase 1

Gene Aliases

GT1, GTB, CDG2D, GGTB2, B4GAL-T1, beta4Gal-T1

Gene ID

2683

Swiss Prot

P15291

Accession Number

NP_001488

Host

Rabbit

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human B4GT1

Target

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity purified

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

43kDa

Shipping Conditions

Wet Ice

Product Datasheet

Anti-B4GALT1 (ARP76190_P050-FITC) antibody

Protein Length

398

NCBI Gene Symbol

B4GALT1

NCBI GB Accession Number

B4GALT1

Host or Source

Rabbit

Protein Name

Beta-1,4-galactosyltransferase 1

Peptide Sequence

MIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-RPLP0 antibody
STJ115592 100 µl

Anti-RPLP0 antibody

Ask
View Details
Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [Alexa Fluor 594]
NBP3-06377AF594 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [Alexa Fluor 594]

Ask
View Details
PDZK1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-9036R-PE-Cy5 100 µL

PDZK1 Polyclonal Antibody, PE-Cy5 Conjugated

Ask
View Details
XFD750 Anti-human CD8 Antibody *HIT8a*
100801B0-AAT 100 Tests

XFD750 Anti-human CD8 Antibody *HIT8a*

Ask
View Details
FXC1 (Mitochondrial import inner Membrane Translocase Subunit Tim10 B, Fracture callus Protein 1, FxC1, Mitochondrial import inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, TIMM10B, FXC1, TIM9B, TIMM9B) (HRP)
MBS6456210-01 0.1 mL

FXC1 (Mitochondrial import inner Membrane Translocase Subunit Tim10 B, Fracture callus Protein 1, FxC1, Mitochondrial import inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, TIMM10B, FXC1, TIM9B, TIMM9B) (HRP)

Ask
View Details
FXC1 (Mitochondrial import inner Membrane Translocase Subunit Tim10 B, Fracture callus Protein 1, FxC1, Mitochondrial import inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, TIMM10B, FXC1, TIM9B, TIMM9B) (HRP)
MBS6456210-02 5x 0.1 mL

FXC1 (Mitochondrial import inner Membrane Translocase Subunit Tim10 B, Fracture callus Protein 1, FxC1, Mitochondrial import inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, TIMM10B, FXC1, TIM9B, TIMM9B) (HRP)

Ask
View Details