Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP4 Antibody - C-terminal region : FITC (ARP30180_P050-FITC)

Product Specifications

Gene Name

FK506 binding protein 4, 59kDa

Gene Aliases

HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase

Gene ID

2288

Swiss Prot

P30416

Accession Number

NP_002005

Host

Rabbit

Reactivity

Human, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4

Target

FKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

HSP90AB1; HSP90AA1; RPS10-NUDT3; CDC37L1; LSM7; CACYBP; CHORDC1; GLMN; CDC37; SUGT1; USP19; PTGES3; AHSA1; UBC; MDM2; MGEA5; TPM3; MCM4; MCM3; SQSTM1; Nr3c1; S100A6; S100A2; S100A1; gag-pol; VCAM1; TAF9; SNCA; SARDH; UBD; PGR; NR3C2; AR; CDK2; SIRT7; SH3B

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB, IHC

Purification

Affinity Purified

Sample Type

FKBP4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Concentration

0.5 mg/ml

Homology

Human: 100%; Pig: 75%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

52kDa

References & Citations

Ruan, B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 33-38

Shipping Conditions

Wet Ice

Product Datasheet

Anti-FKBP4 (ARP30180_P050-FITC) antibody

Protein Length

459

NCBI Gene Symbol

FKBP4

NCBI GB Accession Number

FKBP4

Host or Source

Rabbit

Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP4

Nucleotide Accession Number

NM_002014

Peptide Sequence

ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (PE)
MBS6504990-01 0.2 mL

USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (PE)

Ask
View Details
USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (PE)
MBS6504990-02 5x 0.2 mL

USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (PE)

Ask
View Details
MIR4714 Human qPCR Primer Pair (MI0017348)
HP301103 200 Reactions

MIR4714 Human qPCR Primer Pair (MI0017348)

Ask
View Details
RNPS1 (NM_001286627) Human Tagged ORF Clone
RC236988 10 µg

RNPS1 (NM_001286627) Human Tagged ORF Clone

Ask
View Details
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: LBI1E9]
AMM15685VCF 100 µg

CSNK1G2 Mouse Monoclonal Antibody [Clone ID: LBI1E9]

Ask
View Details
Phospho-Histone H3 (Thr45) Antibody
MBS7115655-01 0.05 mg

Phospho-Histone H3 (Thr45) Antibody

Ask
View Details