Animal-Free TGF beta 1/TGFB1, Human (His)
TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Animal-Free TGF beta 1/TGFB1 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free TGF beta 1/TGFB1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-tgf-beta-1-tgfb1-protein-human-his.html
Purity
98.0
Smiles
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular Formula
7040 (Gene_ID) P01137 (A279-S390) (Accession)
Molecular Weight
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items