Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free TGF beta 1/TGFB1, Human (His)

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Animal-Free TGF beta 1/TGFB1 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free TGF beta 1/TGFB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-tgf-beta-1-tgfb1-protein-human-his.html

Purity

98.0

Smiles

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Formula

7040 (Gene_ID) P01137 (A279-S390) (Accession)

Molecular Weight

Approximately 10 kDa (mature TGFβ1) & 40 kDa (LAP protein) & 50 kDa (inacitve latent TGFβ1), based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Ghadami M, et al. Genetic mapping of the Camurati-Engelmann disease locus to chromosome 19q13.1-q13.3. Am J Hum Genet. 2000 Jan;66 (1) :143-7.|[2]Vaughn SP, et al. Confirmation of the mapping of the Camurati-Englemann locus to 19q13. 2 and refinement to a 3.2-cM region. Genomics. 2000 May 15;66 (1) :119-21.|[3]Chen Q, et al. Sustained induction of collagen synthesis by TGF-β requires regulated intramembrane proteolysis of CREB3L1. PLoS One. 2014 Oct 13;9 (10) :e108528.|[4]Kotlarz D, et al. Human TGF-β1 deficiency causes severe inflammatory bowel disease and encephalopathy. Nat Genet. 2018 Mar;50 (3) :344-348.|[5]Hwangbo C, et al. Syntenin regulates TGF-β1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-β type I receptor internalization. Oncogene. 2016 Jan 21;35 (3) :389-401.|[6]Letterio JJ, rt al. Regulation of immune responses by TGF-beta. Annu Rev Immunol. 1998;16:137-61.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MCC siRNA (m)
sc-149317 10 µM

MCC siRNA (m)

Ask
View Details
P4HA3 Recombinant Protein
OPCD05945-200UG 200 µg

P4HA3 Recombinant Protein

Ask
View Details
CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)
MBS6471105-01 0.1 mL

CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)

Ask
View Details
CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)
MBS6471105-02 5x 0.1 mL

CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)

Ask
View Details
Human PHETA2 (NM_001002034) AAV Particle
RC216895A1V 250 µL

Human PHETA2 (NM_001002034) AAV Particle

Ask
View Details
Acetylacetone
sc-239193 100 mL

Acetylacetone

Ask
View Details