Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-2 (RSPO2), partial

Product Specifications

Product Name Alternative

(Roof plate-specific spondin-2) (hRspo2)

Abbreviation

Recombinant Human RSPO2 protein, partial

Gene Name

RSPO2

UniProt

Q6UXX9

Expression Region

22-205aa

Organism

Homo sapiens (Human)

Target Sequence

QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. During embryonic development, plays a crucial role in limb specification, amplifying the Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3, hence governing the number of limbs an embryo should form.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.8 kDa

References & Citations

"RSPO2 inhibition of RNF43 and ZNRF3 governs limb development independently of LGR4/5/6." Szenker-Ravi E., Altunoglu U., Leushacke M., Bosso-Lefevre C., Khatoo M., Thi Tran H., Naert T., Noelanders R., Hajamohideen A., Beneteau C., de Sousa S.B., Karaman B., Latypova X., Basaran S., Yuecel E.B., Tan T.T., Vlaminck L., Nayak S.S. Reversade B. Nature 557:564-569 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932710/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human FUN14 domain-containing protein 1,FUNDC1 ELISA KIT
JOT-EK7384Hu 96 wells

Human FUN14 domain-containing protein 1,FUNDC1 ELISA KIT

Ask
View Details
Anti-beta-1,4-Gal-T3 B4GALT3 Antibody
A09618T3-1 100 µL

Anti-beta-1,4-Gal-T3 B4GALT3 Antibody

Ask
View Details
Mouse T-cell leukemia/lymphoma protein 1A, Tcl1a ELISA KIT
ELI-05545m 96 Tests

Mouse T-cell leukemia/lymphoma protein 1A, Tcl1a ELISA KIT

Ask
View Details
BMP-8A Double Nickase Plasmid (h2)
sc-406589-NIC-2 20 µg

BMP-8A Double Nickase Plasmid (h2)

Ask
View Details