Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin (MYOC), partial

Product Specifications

Product Name Alternative

Myocilin 55 kDa subunit; Trabecular meshwork-induced glucocorticoid response protein

Abbreviation

Recombinant Human MYOC protein, partial

Gene Name

MYOC

UniProt

Q99972

Expression Region

241-504aa

Organism

Homo sapiens (Human)

Target Sequence

GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Secreted glycoprotein regulating the activation of different signaling pathways in adjacent cells to control different processes including cell adhesion, cell-matrix adhesion, cytoskeleton organization and cell migration. Promotes substrate adhesion, spreading and formation of focal contacts. Negatively regulates cell-matrix adhesion and stress fiber assembly through Rho protein signal transduction. Modulates the organization of actin cytoskeleton by stimulating the formation of stress fibers through interactions with components of Wnt signaling pathways. Promotes cell migration through activation of PTK2 and the downstream phosphatidylinositol 3-kinase signaling. Plays a role in bone formation and promotes osteoblast differentiation in a dose-dependent manner through mitogen-activated protein kinase signaling. Mediates myelination in the peripheral nervous system through ERBB2/ERBB3 signaling. Plays a role as a regulator of muscle hypertrophy through the components of dystrophin-associated protein complex. Involved in positive regulation of mitochondrial depolarization. Plays a role in neurite outgrowth. May participate in the obstruction of fluid outflow in the trabecular meshwork

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943905/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx124258-01 60 µL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Ask
View Details
Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx124258-02 120 µL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Ask
View Details
Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx124258-03 200 µL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Ask
View Details
CD31 (PECAM1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1D2]
TA700246 50 µg

CD31 (PECAM1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1D2]

Ask
View Details
STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 405)
MBS6351790-01 0.1 mL

STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 405)

Ask
View Details
STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 405)
MBS6351790-02 5x 0.1 mL

STARD6, CT (STARD6, StAR-related lipid transfer protein 6, START domain-containing protein 6) (MaxLight 405)

Ask
View Details