Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon gamma (Ifng)

Product Specifications

Product Name Alternative

IFN-gamma; Ifng

Abbreviation

Recombinant Rat Ifng protein

Gene Name

Ifng

UniProt

P01581

Expression Region

23-156aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943858/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vmn1r118 Mouse siRNA Oligo Duplex (Locus ID 667259)
SR409063 1 Kit

Vmn1r118 Mouse siRNA Oligo Duplex (Locus ID 667259)

Ask
View Details
Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)
MBS1218689-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)

Ask
View Details
Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)
MBS1218689-02 0.02 mg (Yeast)

Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)

Ask
View Details
Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)
MBS1218689-03 0.1 mg (E-Coli)

Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)

Ask
View Details
Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)
MBS1218689-04 0.1 mg (Yeast)

Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)

Ask
View Details
Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)
MBS1218689-05 0.02 mg (Baculovirus)

Recombinant Pasteurella multocida 3-dehydroquinate synthase (aroB)

Ask
View Details