Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor X (F10), partial

Product Specifications

Product Name Alternative

Stuart factor; Stuart-Prower factor

Abbreviation

Recombinant Human F10 protein, partial

Gene Name

F10

UniProt

P00742

Expression Region

86-122aa

Organism

Homo sapiens (Human)

Target Sequence

DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCE

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Factor Xa is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting. Factor Xa activates pro-inflammatory signaling pathways in a protease-activated receptor (PAR) -dependent manner. Up-regulates expression of protease-activated receptors (PARs) F2R, F2RL1 and F2RL2 in dermal microvascular endothelial cells. Triggers the production of pro-inflammatory cytokines, such as MCP-1/CCL2 and IL6, in cardiac fibroblasts and umbilical vein endothelial cells in PAR-1/F2R-dependent manner. Triggers the production of pro-inflammatory cytokines, such as MCP-1/CCL2, IL6, TNF-alpha/TNF, IL-1beta/IL1B, IL8/CXCL8 and IL18, in endothelial cells and atrial tissues. Induces expression of adhesion molecules, such as ICAM1, VCAM1 and SELE, in endothelial cells and atrial tissues. Increases expression of phosphorylated ERK1/2 in dermal microvascular endothelial cells and atrial tissues. Triggers activation of the transcription factor NF-kappa-B in dermal microvascular endothelial cells and atrial tissues. Activates pro-inflammatory and pro-fibrotic responses in dermal fibroblasts and enhances wound healing probably via PAR-2/F2RL1-dependent mechanism. Activates barrier protective signaling responses in endothelial cells in PAR-2/F2RL1-dependent manner; the activity depends on the cleavage of PAR-2/F2RL1 by factor Xa. Up-regulates expression of plasminogen activator inhibitor 1 (SERPINE1) in atrial tissues

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

5.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943907/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human MAGEC3 siRNA
abx923315-01 15 nmol

Human MAGEC3 siRNA

Ask
View Details
Human MAGEC3 siRNA
abx923315-02 30 nmol

Human MAGEC3 siRNA

Ask
View Details
IRRα/β HDR Plasmid (m)
sc-423895-HDR 20 µg

IRRα/β HDR Plasmid (m)

Ask
View Details
Lentiviral human DAPK1 shRNA (UAS) - Lentiviral human DAPK1 shRNA (UAS, RFP) plasmid
GTR15339100 1 Vial

Lentiviral human DAPK1 shRNA (UAS) - Lentiviral human DAPK1 shRNA (UAS, RFP) plasmid

Ask
View Details
S1pr5 Mouse shRNA Plasmid (Locus ID 94226)
TL512815 1 Kit

S1pr5 Mouse shRNA Plasmid (Locus ID 94226)

Ask
View Details
Xpress™ Human WIBG Over-expressing Stable Cell Line
ABC-X3450 1 Vial

Xpress™ Human WIBG Over-expressing Stable Cell Line

Ask
View Details