Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)

Product Specifications

Product Name Alternative

Dispanin subfamily A member 2a; Interferon-induced protein 17; Interferon-inducible protein 9-27; Leu-13 antigen

Abbreviation

Recombinant Human IFITM1 protein

Gene Name

IFITM1

UniProt

P13164

Expression Region

1-125aa

Organism

Homo sapiens (Human)

Target Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Immunology

Relevance

IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV) . Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Inhibits SARS-CoV-2 S protein-mediated syncytia formation. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11122138/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Histone cluster 1 H4I CRISPR Activation Plasmid (m)
sc-435563-ACT 20 µg

Histone cluster 1 H4I CRISPR Activation Plasmid (m)

Ask
View Details
CheKineTM Glutathione Oxidized (GSSG) Colorimetric Assay Kit
MBS9718982-01 96 Tests

CheKineTM Glutathione Oxidized (GSSG) Colorimetric Assay Kit

Ask
View Details
CheKineTM Glutathione Oxidized (GSSG) Colorimetric Assay Kit
MBS9718982-02 5x 96 Tests

CheKineTM Glutathione Oxidized (GSSG) Colorimetric Assay Kit

Ask
View Details
DHEA (Dehydroepiandrosterone, Prasterone) (MaxLight 405)
MBS6252785-01 0.1 mL

DHEA (Dehydroepiandrosterone, Prasterone) (MaxLight 405)

Ask
View Details
DHEA (Dehydroepiandrosterone, Prasterone) (MaxLight 405)
MBS6252785-02 5x 0.1 mL

DHEA (Dehydroepiandrosterone, Prasterone) (MaxLight 405)

Ask
View Details
Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42)
4037472.05 0.5 mg

Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42)

Ask
View Details