Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated

Product Specifications

Product Name Alternative

Antigenic surface determinant protein OA3; Integrin-associated protein; Protein MER6

Abbreviation

Recombinant Human CD47 protein, partial, Biotinylated

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal 10xHis-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Adhesive protein that mediates cell-to-cell interactions. Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins. Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. Plays a role in modulating pulmonary endothelin EDN1 signaling. Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering. Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging. In response to THBS1, negatively modulates wound healing. Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943397/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NDHL Antibody
PHY1002S 150 μg

NDHL Antibody

Ask
View Details
Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)
MBS1329407-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)

Ask
View Details
Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)
MBS1329407-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)

Ask
View Details
Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)
MBS1329407-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)

Ask
View Details
Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)
MBS1329407-04 0.1 mg (Yeast)

Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)

Ask
View Details
Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)
MBS1329407-05 0.02 mg (Baculovirus)

Recombinant Salmonella paratyphi A Regulator of sigma D (rsd)

Ask
View Details