Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sendai virus Fusion glycoprotein F0 (F), partial

Product Specifications

Product Name Alternative

Protein F; F

Abbreviation

Recombinant Sendai virus Fusion glycoprotein F0, partial

Gene Name

F

UniProt

P04855

Expression Region

26-116aa

Organism

Sendai virus (strain Z) (SeV) (Sendai virus (strain HVJ) )

Target Sequence

QIPRDRLSNIGVIVDEGKSLKIAGSHESRYIVLSLVPGVDFENGCGTAQVIQYKSLLNRLLIPLRDALDLQEALITVTNDTTQNAGAPQSR

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the heptad repeat (HR) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and plasma cell membranes. Directs fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. This fusion is pH independent and occurs directly at the outer cell membrane. The trimer of F1-F2 (F protein) interacts with HN tetramer at the virion surface. Upon HN binding to its cellular receptor, the hydrophobic fusion peptide is unmasked and interacts with the cellular membrane, inducing the fusion between cell and virion membranes. Later in infection, F proteins expressed at the plasma membrane of infected cells could mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943335/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ces2e Protein Vector (Rat) (pPM-C-HA)
15948026 500 ng

Ces2e Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
IBA1 Monoclonal rat purified IgG
HS-234 017BT 100 µg

IBA1 Monoclonal rat purified IgG

Ask
View Details
SENP7 Lentiviral Activation Particles (h)
sc-405886-LAC 200 µL

SENP7 Lentiviral Activation Particles (h)

Ask
View Details
Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 488]
NBP2-99662AF488 0.1 mL

Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 488]

Ask
View Details
Anti-MYH7 Polyclonal Antibody
PHC95601 100 μg

Anti-MYH7 Polyclonal Antibody

Ask
View Details
Recombinant Proteus mirabilis Phosphopantetheine adenylyltransferase (coaD)
MBS1155627-01 0.02 mg (E-Coli)

Recombinant Proteus mirabilis Phosphopantetheine adenylyltransferase (coaD)

Ask
View Details