Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 alpha (IL1A)

Product Specifications

Product Name Alternative

IL-1 alpha; Hematopoietin-1

Abbreviation

Recombinant Human IL1A protein

Gene Name

IL1A

UniProt

P01583

Expression Region

113-271aa

Organism

Homo sapiens (Human)

Target Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems. After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex. Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4. In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage. In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as signal for genotoxic stress without loss of cell integrity.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12942548/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GJD2 3'UTR Lenti-reporter-Luc Vector
21553081 1.0 μg

GJD2 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Clu (NM_053021) Rat Tagged Lenti ORF Clone
RR214684L3 10 µg

Clu (NM_053021) Rat Tagged Lenti ORF Clone

Ask
View Details
Histone H2B type 1-C/E/F/G/I Polyclonal Conjugated Antibody
C42283 100 µL

Histone H2B type 1-C/E/F/G/I Polyclonal Conjugated Antibody

Ask
View Details
Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)
MBS1367749-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)

Ask
View Details
Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)
MBS1367749-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)

Ask
View Details
Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)
MBS1367749-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Cell cycle protein GpsB (gpsB)

Ask
View Details