Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG) (Active)

Product Specifications

Product Name Alternative

Interferon gamma; IFN-gamma; Immune interferon; IFNG

Abbreviation

Recombinant Human IFNG protein (Active)

Gene Name

IFNG

UniProt

P01579

Expression Region

24-166aa

Organism

Homo sapiens (Human)

Target Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU) .The EC50 is 74.23-96.56 ng/mL. ②Measured by its ability to inhibit proliferation of HT-29 cells.The ED50 for this effect is 0.2120-0.2940 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

References & Citations

Human protein factory for converting the transcriptome into an in vitro- expressed proteome. Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nomura N. Nat. Methods 5:1011-1017 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12942507/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Ahcy Recombinant Protein
PROTP50247-01 20 µg

Mouse Ahcy Recombinant Protein

Ask
View Details
Mouse Ahcy Recombinant Protein
PROTP50247-02 500 µg

Mouse Ahcy Recombinant Protein

Ask
View Details
RNF115 siRNA (Human)
MBS8205159-01 15 nmol

RNF115 siRNA (Human)

Ask
View Details
RNF115 siRNA (Human)
MBS8205159-02 30 nmol

RNF115 siRNA (Human)

Ask
View Details
RNF115 siRNA (Human)
MBS8205159-03 5x 30 nmol

RNF115 siRNA (Human)

Ask
View Details
MAGEA10 Polyclonal Antibody
E-AB-15184-01 20 µL

MAGEA10 Polyclonal Antibody

Ask
View Details