Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-3 (Il3)

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

Abbreviation

Recombinant Mouse Il3 protein

Gene Name

Il3

UniProt

P01586

Expression Region

27-166aa

Organism

Mus musculus (Mouse)

Target Sequence

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Stimulates also mature basophils, eosinophils, and monocytes to become functionally activated. In addition, plays an important role in neural cell proliferation and survival. Participates as well in bone homeostasis and inhibits osteoclast differentiation by preventing NF-kappa-B nuclear translocation and activation. Mechanistically, exerts its biological effects through a receptor composed of IL3RA subunit and a signal transducing subunit IL3RB. Receptor stimulation results in the rapid activation of JAK2 kinase activity leading to STAT5-mediated transcriptional program. Alternatively, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12942422/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Phospho-Nuclear Factor Kappa B ELISA Kit
MBS009763-01 48 Well

Sheep Phospho-Nuclear Factor Kappa B ELISA Kit

Ask
View Details
Sheep Phospho-Nuclear Factor Kappa B ELISA Kit
MBS009763-02 96 Well

Sheep Phospho-Nuclear Factor Kappa B ELISA Kit

Ask
View Details
Sheep Phospho-Nuclear Factor Kappa B ELISA Kit
MBS009763-03 5x 96 Well

Sheep Phospho-Nuclear Factor Kappa B ELISA Kit

Ask
View Details
Sheep Phospho-Nuclear Factor Kappa B ELISA Kit
MBS009763-04 10x 96 Well

Sheep Phospho-Nuclear Factor Kappa B ELISA Kit

Ask
View Details
MAP3K8 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
TA808427 100 µL

MAP3K8 Mouse Monoclonal Antibody [Clone ID: OTI2E10]

Ask
View Details
Rabbit Polyclonal Hyaluronan Synthase 3/HAS3 Antibody
NBP1-86328 0.1 mL

Rabbit Polyclonal Hyaluronan Synthase 3/HAS3 Antibody

Ask
View Details