Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-nerve growth factor (NGF) (R121G)

Product Specifications

Product Name Alternative

Beta-NGF

Abbreviation

Recombinant Human NGF protein (R121G)

Gene Name

NGF

UniProt

P01138

Expression Region

19-241aa (R121G)

Organism

Homo sapiens (Human)

Target Sequence

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKGSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (Probable) . The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro) . Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12942420/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VRK2 (NM_001130482) Human Tagged ORF Clone Lentiviral Particle
RC225827L3V 200 µL

VRK2 (NM_001130482) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
γ-Actin (1-37)
sc-65637 200 µg/mL

γ-Actin (1-37)

Ask
View Details
Rabbit Polyclonal E6AP/UBE3A Antibody [Allophycocyanin]
NB500-239APC 0.1 mL

Rabbit Polyclonal E6AP/UBE3A Antibody [Allophycocyanin]

Ask
View Details
Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)
abx308784-01 20 µg

Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)

Ask
View Details
Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)
abx308784-02 50 µg

Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)

Ask
View Details
Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)
abx308784-03 100 µg

Sperm Protein Associated With The Nucleus On The X Chromosome D (SPANXD) Antibody (FITC)

Ask
View Details