Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neutral amino acid transporter 9 (SLC38A9), partial

Product Specifications

Product Name Alternative

Solute carrier family 38 member 9; Up-regulated in lung cancer 11

Abbreviation

Recombinant Human SLC38A9 protein, partial

Gene Name

SLC38A9

UniProt

Q8NBW4

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12942298/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (FITC)
MBS6350209-01 0.2 mL

SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (FITC)

Ask
View Details
SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (FITC)
MBS6350209-02 5x 0.2 mL

SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (FITC)

Ask
View Details
Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)
MBS1458509-01 0.02 mg (E-Coli)

Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)

Ask
View Details
Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)
MBS1458509-02 0.1 mg (E-Coli)

Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)

Ask
View Details
Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)
MBS1458509-03 0.02 mg (Yeast)

Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)

Ask
View Details
Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)
MBS1458509-04 0.1 mg (Yeast)

Recombinant Bovine V-type proton ATPase subunit F (ATP6V1F)

Ask
View Details