Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Mouse (HEK293, Fc)

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 76 amino acids (V30-S105) .

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf-4-cxcl4-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Formula

56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109 (10) :4127-34.|[2]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[3]Gabriele Domschke, et al. CXCL4-induced macrophages in human atherosclerosis. Cytokine. 2019 Oct;122:154141.|[4]Merry L Lindsey, et al. Exogenous CXCL4 infusion inhibits macrophage phagocytosis by limiting CD36 signalling to enhance post-myocardial infarction cardiac dilation and mortality.Cardiovasc Res. 2019 Feb 1;115 (2) :395-408.|[5]Mirko Moreno Zaldivar, et al. CXC chemokine ligand 4 (Cxcl4) is a platelet-derived mediator of experimental liver fibrosis. Hepatology. 2010 Apr;51 (4) :1345-53.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phospho-PRKDC-S2056 Polyclonal Antibody
MBS9128994-01 0.02 mL

Phospho-PRKDC-S2056 Polyclonal Antibody

Ask
View Details
Phospho-PRKDC-S2056 Polyclonal Antibody
MBS9128994-02 0.1 mL

Phospho-PRKDC-S2056 Polyclonal Antibody

Ask
View Details
Phospho-PRKDC-S2056 Polyclonal Antibody
MBS9128994-03 5x 0.1 mL

Phospho-PRKDC-S2056 Polyclonal Antibody

Ask
View Details
(+/-)8(9)-EpETE
MBS5798174 Inquire

(+/-)8(9)-EpETE

Ask
View Details
Cytohesin 1 (CYTH1) (NM_017456) Human Untagged Clone
SC313294 10 µg

Cytohesin 1 (CYTH1) (NM_017456) Human Untagged Clone

Ask
View Details
Recombinant Pan paniscus Hemoglobin subunit epsilon (HBE1)
MBS1432035-01 0.02 mg (E-Coli)

Recombinant Pan paniscus Hemoglobin subunit epsilon (HBE1)

Ask
View Details