Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype G Protein Vpr (vpr)

Product Specifications

Product Name Alternative

R ORF protein; Viral protein R

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype G vpr protein

Gene Name

Vpr

UniProt

O89942

Expression Region

1-96aa

Organism

Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) (HIV-1)

Target Sequence

MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells. ; During virus entry, plays a role in the transport of the viral pre-integration (PIC) complex to the host nucleus. This function is crucial for viral infection of non-dividing macrophages. May act directly at the nuclear pore complex, by binding nucleoporins phenylalanine-glycine (FG) -repeat regions.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12936770/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Puumala Virus Nucleocapsid Antibody
NBP2-41261-0.025mg 0.025 mg

Rabbit Polyclonal Puumala Virus Nucleocapsid Antibody

Ask
View Details
VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide
MBS6225893-01 0.1 mL

VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide

Ask
View Details
VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide
MBS6225893-02 5x 0.1 mL

VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide

Ask
View Details
Rat Neuroglobin (NGB) ELISA kit
EIA06111r 96 Well

Rat Neuroglobin (NGB) ELISA kit

Ask
View Details
Recombinant Staphylococcus aureus Leucine--tRNA ligase (leuS), partial
MBS1205542-01 1 mg (E-Coli)

Recombinant Staphylococcus aureus Leucine--tRNA ligase (leuS), partial

Ask
View Details
Recombinant Staphylococcus aureus Leucine--tRNA ligase (leuS), partial
MBS1205542-02 1 mg (Yeast)

Recombinant Staphylococcus aureus Leucine--tRNA ligase (leuS), partial

Ask
View Details