Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone deacetylase 4 (HDAC4), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human HDAC4 protein, partial

Gene Name

HDAC4

UniProt

P56524

Expression Region

1-227aa

Organism

Homo sapiens (Human)

Target Sequence

MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNH

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Deacetylates HSPA1A and HSPA1B at 'Lys-77' leading to their preferential binding to co-chaperone STUB1

Molecular Weight

53.3 kDa

References & Citations

Regulation of histone deacetylase 4 by binding of 14-3-3 proteins.Wang A.H., Kruhlak M.J., Wu J., Bertos N.R., Vezmar M., Posner B.I., Bazett-Jones D.P., Yang X.-J.Mol. Cell. Biol. 20:6904-6912 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12550132/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Beta-Amyloid (1-11)
A1002-1 1 mg

Beta-Amyloid (1-11)

Ask
View Details
TNFRSF6B, NT (TNFRSF6B, DCR3, TR6, Tumor necrosis factor receptor superfamily member 6B, Decoy receptor 3, Decoy receptor for Fas ligand, M68)
MBS642741-01 0.2 mL

TNFRSF6B, NT (TNFRSF6B, DCR3, TR6, Tumor necrosis factor receptor superfamily member 6B, Decoy receptor 3, Decoy receptor for Fas ligand, M68)

Ask
View Details
TNFRSF6B, NT (TNFRSF6B, DCR3, TR6, Tumor necrosis factor receptor superfamily member 6B, Decoy receptor 3, Decoy receptor for Fas ligand, M68)
MBS642741-02 5x 0.2 mL

TNFRSF6B, NT (TNFRSF6B, DCR3, TR6, Tumor necrosis factor receptor superfamily member 6B, Decoy receptor 3, Decoy receptor for Fas ligand, M68)

Ask
View Details
DES Conjugated Antibody
MBS9452172-01 0.1 mL (Biotin)

DES Conjugated Antibody

Ask
View Details
DES Conjugated Antibody
MBS9452172-02 0.1 mL (AF350)

DES Conjugated Antibody

Ask
View Details
DES Conjugated Antibody
MBS9452172-03 0.1 mL (AF405)

DES Conjugated Antibody

Ask
View Details