Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell division cycle and apoptosis regulator protein 1 (CCAR1), partial

Product Specifications

Product Name Alternative

Cell cycle and apoptosis regulatory protein 1; CARP-1; Death inducer with SAP domain

Abbreviation

Recombinant Human CCAR1 protein, partial

Gene Name

CCAR1

UniProt

Q8IX12

Expression Region

1-249aa

Organism

Homo sapiens (Human)

Target Sequence

MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQTQPQPQSLLQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation. May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein (s) and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation. In association with CALCOCO1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells. Can act as a both a coactivator and corepressor of AR-mediated transcription. Contributes to chromatin looping and AR transcription complex assembly by stabilizing AR-GATA2 association on chromatin and facilitating MED1 and RNA polymerase II recruitment to AR-binding sites. May play an important role in the growth and tumorigenesis of prostate cancer cells.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12935693/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-01 0.1 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details
PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-02 0.2 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details
PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-03 0.5 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details
PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-04 1 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details
PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-05 5 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details
PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
MBS2041425-06 5x 5 mL

PE-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)

Ask
View Details