Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hainantoxin-III

Hainantoxin-III (HNTX-III; hainantoxin-3) is a peptide that has been isolated from the venom of the Chinese bird spider Seleconosmia hainana. Hainantoxin-III specifically blocks mammalian neuronal tetrodotoxin-sensitive voltage-gated sodium channels (VGSCs) . Hainantoxin III was found inactive on tetrodotoxin-resistant VGSCs and voltage-gated Ca2+channels (both high and low voltage-activated) . Hainantoxin-III strongly depressed the amplitude of rat DRG tetrodotoxin-sensitive Na+ currents with an IC50 value of 1.1 nM. Like Hainantoxin-IV, Hainantoxin-III causes a hyperpolarizing shift of about 10 mV in the voltage midpoint of steady-state Na+ channel inactivation. Similar to Huwentoxin-IV, Hainantoxin-III and Hainantoxin-IV do not affect the activation and inactivation kinetics of Na+ currents. Hainantoxin-III inhibits Nav1.7 current amplitude without significantly altering the activation and inactivation kinetics. Hainantoxin-III increases the deactivation of the Nav1.7 current after extreme depolarizations. Hainantoxin-III seems to interact with site 4 and to trap the domain II voltage sensor in the closed state. The inhibition of Nav1.7 by hainantoxin-III is reversible upon washing, but no reversibility was observed for Hainantoxin-IV and Huwentoxin-IV. Hainantoxin-III was shown to block Nav1.1, Nav1.2, Nav1.3 and Nav1.7 expressed in HEK293 cells with IC50 values of 1.27 µM, 275 nM, 491 nM and 232 nM, respectively

Product Specifications

Specifications

Selective blocker of TTX-S VGSC

Target

Na channels

Sequence

GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL

Peptide Number

13HTX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys22; ; Cys16-Cys29

N Terminal Sequence

H

C Terminal Sequence

NH2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PathScan® RP Phospho-TFEB (Ser211) Sandwich ELISA Kit
CST 57002C 1 Kit

PathScan® RP Phospho-TFEB (Ser211) Sandwich ELISA Kit

Ask
View Details
BAAT Antibody
61-261 200 µL

BAAT Antibody

Ask
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
MBS1579819-01 0.1 mg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Ask
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
MBS1579819-02 1 mg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Ask
View Details
InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)
MBS1579819-03 5x 1 mg

InVivoMAb Anti-MERS-CoV S1 N-terminal domain/S1-NTD Antibody (G2)

Ask
View Details
phospho-LCK (Tyr394) Polyclonal Antibody PE Conjugated
MBS9463804-01 0.1 mL

phospho-LCK (Tyr394) Polyclonal Antibody PE Conjugated

Ask
View Details