Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-agatoxin-IVA

ω-agatoxin-IVA (ω-AGA IVA) is a peptide originally isolated from funnel web-spider venom Agelenopsis aperta. This peptide is a specific blocker of P/Q-type calcium channel (Cav2.1) . It has been reported that ω-agatoxin IVA is a potent blocker of voltage-gated calcium channels in insect and vertebrate central neurons. The binding site for ω-agatoxin IVA has been localized in part to the extracellular S3–S4 loop in repeat IV of the α-1A Ca2+ channels, which is proximal to the S4 sensor domain. This is coherent with its functional effect (no pore-blocking activity, but gating modifier by a shift of channel activation towards more depolarized potentials) . This makes this toxin a voltage-dependent blocker of P/Q calcium channels.

Product Specifications

Specifications

Blocker of P/Q-type calcium channel (Cav2.1)

Target

Ca channels

Sequence

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Peptide Number

11AGA001

Disulfide Bonds

Cys4-Cys20; Cys12-Cys25; Cys19-Cys36; Cys27-Cys34

N Terminal Sequence

H

C Terminal Sequence

OH

CAS Number

145017-83-0

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Glutamate receptor, ionotropic kainate 1 (GRIK1) ELISA Kit
E08G0396-01 48 Well

Canine Glutamate receptor, ionotropic kainate 1 (GRIK1) ELISA Kit

Ask
View Details
Canine Glutamate receptor, ionotropic kainate 1 (GRIK1) ELISA Kit
E08G0396-02 96 Well

Canine Glutamate receptor, ionotropic kainate 1 (GRIK1) ELISA Kit

Ask
View Details
Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit
MBS7243598-01 48 Well

Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit

Ask
View Details
Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit
MBS7243598-02 96 Well

Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit

Ask
View Details
Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit
MBS7243598-03 5x 96 Well

Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit

Ask
View Details
Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit
MBS7243598-04 10x 96 Well

Chicken WD40 repeat-containing protein SMU1 (SMU1) ELISA Kit

Ask
View Details