Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jingzhaotoxin-III

Jingzhaotoxin-III (ß-TRTX-Cj1α) has been isolated initially from the Chinese Tarantula spider Chilobrachys Jingzhaovenom. Jingzhaotoxin-III selectively inhibits the activation of the voltage-dependent sodium channel Nav1.5 in heart or cancer cells with an IC50value close to 350 nM. It is inactive on Nav1.2, Nav1.4, Nav1.6 and Nav1.7 and should therefore be considered as an interesting research tool to discriminate between sodium channel subtypes. Jingzhaotoxin-III binds onto receptor site 4 presumably located on DIIS3-S4 linker of Nav1.5 and supposedly blocks Nav1.5 through a different mechanism than ProTx-II and Huwentoxin IV. ß-TRTX-Cj1α is composed of 36 amino acid residues including 6 cysteines cross-linked according to a C1-C4, C2-C5 and C3-C6 pattern. Jingzhaotoxin-III also inhibits Kv2.1 channel with an IC50 of around 700 nM.

Product Specifications

Specifications

Selective blocker of Nav1.5 channel

Target

Na channels

Sequence

DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

Peptide Number

12JZH003

Disulfide Bonds

Cys4-Cys19; Cys11-Cys24; ; Cys18-Cys31

N Terminal Sequence

H

C Terminal Sequence

OH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Casein kinase II subunit beta Protein, GST, E.coli-1mg
QP8381-ec-1mg 1mg

Recombinant Human Casein kinase II subunit beta Protein, GST, E.coli-1mg

Ask
View Details
WNT10B Adenovirus (Mouse)
50445054 1.0 ml

WNT10B Adenovirus (Mouse)

Ask
View Details
PARP-1 (B-10) Alexa Fluor® 680
sc-74470 AF680 200 µg/mL

PARP-1 (B-10) Alexa Fluor® 680

Ask
View Details
LTBR, NT (LTBR, D12S370, TNFCR, TNFR3, TNFRSF3, Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III) (M
MBS6317545-01 0.1 mL

LTBR, NT (LTBR, D12S370, TNFCR, TNFR3, TNFRSF3, Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III) (M

Ask
View Details
LTBR, NT (LTBR, D12S370, TNFCR, TNFR3, TNFRSF3, Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III) (M
MBS6317545-02 5x 0.1 mL

LTBR, NT (LTBR, D12S370, TNFCR, TNFR3, TNFRSF3, Tumor necrosis factor receptor superfamily member 3, Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III) (M

Ask
View Details