Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jingzhaotoxin-III

Jingzhaotoxin-III (ß-TRTX-Cj1α) has been isolated initially from the Chinese Tarantula spider Chilobrachys Jingzhaovenom. Jingzhaotoxin-III selectively inhibits the activation of the voltage-dependent sodium channel Nav1.5 in heart or cancer cells with an IC50value close to 350 nM. It is inactive on Nav1.2, Nav1.4, Nav1.6 and Nav1.7 and should therefore be considered as an interesting research tool to discriminate between sodium channel subtypes. Jingzhaotoxin-III binds onto receptor site 4 presumably located on DIIS3-S4 linker of Nav1.5 and supposedly blocks Nav1.5 through a different mechanism than ProTx-II and Huwentoxin IV. ß-TRTX-Cj1α is composed of 36 amino acid residues including 6 cysteines cross-linked according to a C1-C4, C2-C5 and C3-C6 pattern. Jingzhaotoxin-III also inhibits Kv2.1 channel with an IC50 of around 700 nM.

Product Specifications

Specifications

Selective blocker of Nav1.5 channel

Target

Na channels

Sequence

DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

Peptide Number

12JZH003

Disulfide Bonds

Cys4-Cys19; Cys11-Cys24; ; Cys18-Cys31

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 Antibody
MBS9408021-01 0.1 mL

MSH2 Antibody

Sign In for Pricing
View Details
MSH2 Antibody
MBS9408021-02 5x 0.1 mL

MSH2 Antibody

Sign In for Pricing
View Details
genesig Real-time PCR detection kit for Parechovirus
Z-Path-Parechovirus 150 Tests

genesig Real-time PCR detection kit for Parechovirus

Sign In for Pricing
View Details
Calponin 2 (CNN2) Monoclonal Antibody
CAU33683-01 100 µL

Calponin 2 (CNN2) Monoclonal Antibody

Sign In for Pricing
View Details
Calponin 2 (CNN2) Monoclonal Antibody
CAU33683-02 200 µL

Calponin 2 (CNN2) Monoclonal Antibody

Sign In for Pricing
View Details
Calponin 2 (CNN2) Monoclonal Antibody
CAU33683-03 1 mL

Calponin 2 (CNN2) Monoclonal Antibody

Sign In for Pricing
View Details