Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jingzhaotoxin-III

Jingzhaotoxin-III (ß-TRTX-Cj1α) has been isolated initially from the Chinese Tarantula spider Chilobrachys Jingzhaovenom. Jingzhaotoxin-III selectively inhibits the activation of the voltage-dependent sodium channel Nav1.5 in heart or cancer cells with an IC50value close to 350 nM. It is inactive on Nav1.2, Nav1.4, Nav1.6 and Nav1.7 and should therefore be considered as an interesting research tool to discriminate between sodium channel subtypes. Jingzhaotoxin-III binds onto receptor site 4 presumably located on DIIS3-S4 linker of Nav1.5 and supposedly blocks Nav1.5 through a different mechanism than ProTx-II and Huwentoxin IV. ß-TRTX-Cj1α is composed of 36 amino acid residues including 6 cysteines cross-linked according to a C1-C4, C2-C5 and C3-C6 pattern. Jingzhaotoxin-III also inhibits Kv2.1 channel with an IC50 of around 700 nM.

Product Specifications

Specifications

Selective blocker of Nav1.5 channel

Target

Na channels

Sequence

DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

Peptide Number

12JZH003

Disulfide Bonds

Cys4-Cys19; Cys11-Cys24; ; Cys18-Cys31

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Dynein (Axonemal (Heavy Chain 11 (DNAH11) ELISA
KBH2664 1x 96 Well

GENLISA™ Human Dynein (Axonemal (Heavy Chain 11 (DNAH11) ELISA

Sign In for Pricing
View Details
SPOP Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62082R-PerCP-Cy5.5 100 µL

SPOP Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Cobalamin Binding Intrinsic Factor (CBLIF) Antibody
abx455037-01 50 µg

Cobalamin Binding Intrinsic Factor (CBLIF) Antibody

Sign In for Pricing
View Details
Cobalamin Binding Intrinsic Factor (CBLIF) Antibody
abx455037-02 100 µg

Cobalamin Binding Intrinsic Factor (CBLIF) Antibody

Sign In for Pricing
View Details
AGPAT4 Knockout HAP1 Polyclonal Cells
ARG21737 1 Million

AGPAT4 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
FOSL1 Rabbit pAb
A5372-01 20 µL

FOSL1 Rabbit pAb

Sign In for Pricing
View Details