Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-I

Huwentoxin-I (HwTx-I) is a neurotoxin that was originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated sodium channels (TTX-S) (IC50 ~ 50 nM) and N-type voltage-sensitive calcium channels (IC50 ~ 100 nM) in mammalian DRG, hippocampus and insect’s DUM neurons. It has only a very weak effect on L-type calcium channels, no effect on TTX-R channels and has virtually no effect on muscle sodium channels. The selectivity of Huwentoxin-I for calcium channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA. Huwentoxin-I demonstrated an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~ 0.28 µg/kg), without side effects of the ones led by ω-conotoxin MVIIA.

Product Specifications

Specifications

Blocker of N-type Ca2+ channel and TTX-S channels

Target

Na channels

Sequence

ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL

Peptide Number

07HWT001

Disulfide Bonds

Cys2-Cys17; Cys9-Cys22; Cys16-Cys29

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Array - 37 Different Ovarian Tumors and 3 Corresponding Normal Controls
T6235183-5 5 Slides

Frozen Tissue Array - 37 Different Ovarian Tumors and 3 Corresponding Normal Controls

Sign In for Pricing
View Details
Human ZNF334 (NM_001270497) AAV Particle
RC234704A1V 250 µL

Human ZNF334 (NM_001270497) AAV Particle

Sign In for Pricing
View Details
NDUFAF2, ID (NDUFAF2, NDUFA12L, Mimitin, mitochondrial, B17.2-like, Myc-induced mitochondrial protein, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2, NDUFA12-like protein)
038862 200 µL

NDUFAF2, ID (NDUFAF2, NDUFA12L, Mimitin, mitochondrial, B17.2-like, Myc-induced mitochondrial protein, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2, NDUFA12-like protein)

Sign In for Pricing
View Details
GRXC11 Antibody
orb839949 2 mg

GRXC11 Antibody

Sign In for Pricing
View Details
Tris-HCl Buffer 1M, pH 7.0
42020256-4 3 L

Tris-HCl Buffer 1M, pH 7.0

Sign In for Pricing
View Details
OSBPL1A 3'UTR Luciferase Stable Cell Line
TU017166 1.0 mL

OSBPL1A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details