Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-I

Huwentoxin-I (HwTx-I) is a neurotoxin that was originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated sodium channels (TTX-S) (IC50 ~ 50 nM) and N-type voltage-sensitive calcium channels (IC50 ~ 100 nM) in mammalian DRG, hippocampus and insect’s DUM neurons. It has only a very weak effect on L-type calcium channels, no effect on TTX-R channels and has virtually no effect on muscle sodium channels. The selectivity of Huwentoxin-I for calcium channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA. Huwentoxin-I demonstrated an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~ 0.28 µg/kg), without side effects of the ones led by ω-conotoxin MVIIA.

Product Specifications

Specifications

Blocker of N-type Ca2+ channel and TTX-S channels

Target

Na channels

Sequence

ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL

Peptide Number

07HWT001

Disulfide Bonds

Cys2-Cys17; Cys9-Cys22; Cys16-Cys29

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD1 (RAD1 Homolog (S. pombe), HRAD1, REC1) (Biotin)
250826-Biotin 100 µL

RAD1 (RAD1 Homolog (S. pombe), HRAD1, REC1) (Biotin)

Sign In for Pricing
View Details
IGHV1OR15-5 sgRNA CRISPR Lentivector (Human) (Target 2)
K1035203 1.0 µg DNA

IGHV1OR15-5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CDHR5 siRNA (Mouse)
orb1840619-01 15 nmol

CDHR5 siRNA (Mouse)

Sign In for Pricing
View Details
CDHR5 siRNA (Mouse)
orb1840619-02 30 nmol

CDHR5 siRNA (Mouse)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)
MBS2108600-01 0.1 mL

APC/Cy7 Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)
MBS2108600-02 0.2 mL

APC/Cy7 Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)

Sign In for Pricing
View Details