Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BeKm-1

BeKm-1 toxin is a peptide toxin that has been isolated from the venom of the Central Asian scorpion Buthus eupeus. BeKm-1 toxin has been reported to be a highly selective inhibitor of the human ether-a-go-go ERG1 channel (hERG1) . BeKm-1 inhibits hERG1 channels expressed in HEK-293 cells with an IC50 of 3.3 nM, but has no effect at 100 nM on human EAG, human SK1, rat SK2, human IK, human BK, KCNQ1/KCNE1, KCNQ2/KCNQ3, and KCNQ4 channels. It has also minimal effects on rat ELK1 channel. BeKm-1 inhibits the human ERG1 + KCNE1 combination transiently expressed in HEK-293 cells with an IC50 value in the range of 10 to 30 nM. BeKm-1 toxin preferentially blocks human ERG channel through the closed (resting) state, although some open channel blockade is also reported to occur.

Product Specifications

Specifications

Selective blocker of ERG1 channel

Target

K channels

Sequence

RPTDIKCSESYNCFPVCKSRFGKTNGRCVNGFCDCF

Peptide Number

13BEK001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal OSMR beta Antibody (007) [Biotin]
NBP2-89851B 0.1 mL

Rabbit Monoclonal OSMR beta Antibody (007) [Biotin]

Sign In for Pricing
View Details
PML Blocking Peptide
abx063097-01 1 mg

PML Blocking Peptide

Sign In for Pricing
View Details
PML Blocking Peptide
abx063097-02 5 mg

PML Blocking Peptide

Sign In for Pricing
View Details
Rat Monoclonal HLA ABC Antibody (YTH862.2) [DyLight 550]
NB100-65411R 0.1 mL

Rat Monoclonal HLA ABC Antibody (YTH862.2) [DyLight 550]

Sign In for Pricing
View Details
Hat1 (NM_026115) Mouse Tagged ORF Clone
MG206588 10 µg

Hat1 (NM_026115) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tdp1 (NM_001031657) Rat Tagged ORF Clone Lentiviral Particle
RR211578L3V 200 µL

Tdp1 (NM_001031657) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details