Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BeKm-1

BeKm-1 toxin is a peptide toxin that has been isolated from the venom of the Central Asian scorpion Buthus eupeus. BeKm-1 toxin has been reported to be a highly selective inhibitor of the human ether-a-go-go ERG1 channel (hERG1) . BeKm-1 inhibits hERG1 channels expressed in HEK-293 cells with an IC50 of 3.3 nM, but has no effect at 100 nM on human EAG, human SK1, rat SK2, human IK, human BK, KCNQ1/KCNE1, KCNQ2/KCNQ3, and KCNQ4 channels. It has also minimal effects on rat ELK1 channel. BeKm-1 inhibits the human ERG1 + KCNE1 combination transiently expressed in HEK-293 cells with an IC50 value in the range of 10 to 30 nM. BeKm-1 toxin preferentially blocks human ERG channel through the closed (resting) state, although some open channel blockade is also reported to occur.

Product Specifications

Specifications

Selective blocker of ERG1 channel

Target

K channels

Sequence

RPTDIKCSESYNCFPVCKSRFGKTNGRCVNGFCDCF

Peptide Number

13BEK001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NDR2 Rabbit Polyclonal Antibody
MBS9512243-01 0.05 mL

NDR2 Rabbit Polyclonal Antibody

Ask
View Details
NDR2 Rabbit Polyclonal Antibody
MBS9512243-02 0.1 mL

NDR2 Rabbit Polyclonal Antibody

Ask
View Details
NDR2 Rabbit Polyclonal Antibody
MBS9512243-03 5x 0.1 mL

NDR2 Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Enterobacteria phage P7 DNA-invertase (cin)
MBS1222284-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage P7 DNA-invertase (cin)

Ask
View Details
Recombinant Enterobacteria phage P7 DNA-invertase (cin)
MBS1222284-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage P7 DNA-invertase (cin)

Ask
View Details
Recombinant Enterobacteria phage P7 DNA-invertase (cin)
MBS1222284-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage P7 DNA-invertase (cin)

Ask
View Details