Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aah-II

AaH-II was originally discovered from the venom of the scorpion Androctonus australis Hector and belongs to alpha-toxins. It is a 64 amino-acid peptide that comprises four disulfide bonds and structured according a beta1-alpha-beta2-beta3 scaffold. Iodinated AaH-II binds with a 3 nM affinity to axolemma from rat Central Nervous System (DeVries and Lazdunski, 1982) . In frog myelinated nerve fibres, AaH-II prolongs the inactivation time constants of the inward Na+ current and induces a persistent current component (Benoit & Dubois, 1986) . By these two effects combined, AaH-II causes prolonged action potentials and thereby decreased firing frequencies. These effects are susceptible to produce paralysis, cardiac arrhythmia and death, including in humans (Bosmans & Tytgat, 2007) . Concerning the selectivity, the reported EC50 values for slowing channel inactivation are 3 nM for rat Nav1.2 and 2 nM for rat Nav1.4 channels (Alami et al., 2003) . The EC50 value on Nav1.7 is 52 nM. At the functional level, AaH-II was shown to bind onto the voltage-sensor of domain IV to block fast inactivation by trapping a deactivated state. (Clairfeuille et al., 2019) . Smartox now proposes the synthetic version of AaH-II.

Product Specifications

Specifications

Slowing of Nav1.2, Nav1.4 and Nav1.7 channels' inactivation

Target

Na channels

Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Peptide Number

AAH001

Disulfide Bonds

Cys1-Cys8; Cys2-Cys5; Cys3-Cys6; Cys4-Cys7

N Terminal Sequence

H

C Terminal Sequence

NH2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Myeloperoxidase ELISA Kit
MBS738468-01 48 Well

Canine Myeloperoxidase ELISA Kit

Ask
View Details
Canine Myeloperoxidase ELISA Kit
MBS738468-02 96 Well

Canine Myeloperoxidase ELISA Kit

Ask
View Details
Canine Myeloperoxidase ELISA Kit
MBS738468-03 5x 96 Well

Canine Myeloperoxidase ELISA Kit

Ask
View Details
Canine Myeloperoxidase ELISA Kit
MBS738468-04 10x 96 Well

Canine Myeloperoxidase ELISA Kit

Ask
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) RTS Polyclonal Antibody
MBS9016747 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) RTS Polyclonal Antibody

Ask
View Details
Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone
RG212810 10 µg

Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone

Ask
View Details