Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4

Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM) . It has been reported that exendin-4 is a more potent insulinotropic agent when given intravenously to rats than is glucagon-like peptide-1 (GLP-1) as indicated by the lower ED50 (ED50 0.19 nmol/kg for glucagon-like peptide-1 versus 0.0143 nmol/kg for exendin-4) 3. Subcutaneous administration of exendin-4 at doses of 5µg and 10 µg twice daily attenuates glycemia in patients with type 2 diabetes, who are treated with metformin, an antidiabetic drug and not achieving adequate glycemic control4. In these patients, exendin-4 was tolerated and triggered a reduction in glycated hemoglobin (HbA1C ≤ 7%), with no weight gain and no increased incidence of hypoglycemia4. Long-term treatment with exendin-4 has a beneficial effect on the pancreatic β-cell function by stimulating both the neogeneration and the proliferation of β-cells when administered to rats2. Furthermore, exendin-4 has shown anti-atherosclerogenetic properties5 as well as the ability to reduce hepatic steatosis in obese ob/ob mice by improving insulin sensitivity

Product Specifications

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Peptide Number

SB029

CAS Number

141758-74-9

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal NDUFAF5 Antibody
NBP2-93003-0.02mL 0.02 mL

Rabbit Polyclonal NDUFAF5 Antibody

Ask
View Details
Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Recombinant Protein
E45H31254E1 50 ug

Nuclear Factor Erythroid Derived 2 (NFE2) (NM_001136023) Human Recombinant Protein

Ask
View Details
CEP57 Protein, Human, Recombinant (GST Tag)
PH51987E6 100 µg

CEP57 Protein, Human, Recombinant (GST Tag)

Ask
View Details
SOX2 Human shRNA Plasmid Kit (Locus ID 6657)
TL309173 1 Kit

SOX2 Human shRNA Plasmid Kit (Locus ID 6657)

Ask
View Details
B3GNT2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
12937114 3 x 1.0 µg

B3GNT2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details