Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4

Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM) . It has been reported that exendin-4 is a more potent insulinotropic agent when given intravenously to rats than is glucagon-like peptide-1 (GLP-1) as indicated by the lower ED50 (ED50 0.19 nmol/kg for glucagon-like peptide-1 versus 0.0143 nmol/kg for exendin-4) 3. Subcutaneous administration of exendin-4 at doses of 5µg and 10 µg twice daily attenuates glycemia in patients with type 2 diabetes, who are treated with metformin, an antidiabetic drug and not achieving adequate glycemic control4. In these patients, exendin-4 was tolerated and triggered a reduction in glycated hemoglobin (HbA1C ≤ 7%), with no weight gain and no increased incidence of hypoglycemia4. Long-term treatment with exendin-4 has a beneficial effect on the pancreatic β-cell function by stimulating both the neogeneration and the proliferation of β-cells when administered to rats2. Furthermore, exendin-4 has shown anti-atherosclerogenetic properties5 as well as the ability to reduce hepatic steatosis in obese ob/ob mice by improving insulin sensitivity

Product Specifications

CAS Number

141758-74-9

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Peptide Number

SB029

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RS 87337
MBS5775872 Inquire

RS 87337

Sign In for Pricing
View Details
Rabbit Monoclonal MRPS31 Antibody (S04-4C1)
NBP3-19699-100ul 100 µL

Rabbit Monoclonal MRPS31 Antibody (S04-4C1)

Sign In for Pricing
View Details
Human AQR qPCR Primer Pair
QH29373S 200 Tests

Human AQR qPCR Primer Pair

Sign In for Pricing
View Details
Anti-PET117 Antibody, Rabbit Polyclonal
MBS8109546-01 0.1 mL

Anti-PET117 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-PET117 Antibody, Rabbit Polyclonal
MBS8109546-02 5x 0.1 mL

Anti-PET117 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Ginsenoside F3
300344 10 mg

Ginsenoside F3

Sign In for Pricing
View Details