Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family. Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair. mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL) . Antimicrobial activity has also been demonstrated against C.Albicans. The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.

Product Specifications

Product Name Alternative

MBD3

Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Peptide Number

SB003

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-FOLH1 / PSMA (Prostate Epithelial Marker)(FOLH1/2121), CF568 conjugate
BNC682121-100 100 µL

Anti-FOLH1 / PSMA (Prostate Epithelial Marker)(FOLH1/2121), CF568 conjugate

Ask
View Details
BIN3 AAV Vector (Mouse) (CMV)
13328104 1 μg

BIN3 AAV Vector (Mouse) (CMV)

Ask
View Details
COL8A1 Antibody
CSB-PA005755GA01HU 100 µL

COL8A1 Antibody

Ask
View Details