Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family. Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair. mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL) . Antimicrobial activity has also been demonstrated against C.Albicans. The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.

Product Specifications

Product Name Alternative

MBD3

Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Peptide Number

SB003

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MSANTD5 Protein
E30P11935 20 µg

Recombinant Human MSANTD5 Protein

Sign In for Pricing
View Details
Mouse Monoclonal Vimentin Antibody (LN-6)
NBP2-44832-0.1mg 0.1 mg

Mouse Monoclonal Vimentin Antibody (LN-6)

Sign In for Pricing
View Details
TGM1 Antibody Affinity Purified
MBS540346-01 0.1 mg

TGM1 Antibody Affinity Purified

Sign In for Pricing
View Details
TGM1 Antibody Affinity Purified
MBS540346-02 5x 0.1 mg

TGM1 Antibody Affinity Purified

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF594 conjugate, 0.1mg/mL
BNC943607-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chicken GDF5 ELISA Kit
ECKG0143 96 Tests

Chicken GDF5 ELISA Kit

Sign In for Pricing
View Details