Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 Spike RBD 395-430 peptide

SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD) . SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 395-430 (Biotin-LC) peptide

Product Specifications

Sequence

VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT

Peptide Number

SB091

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GLRX2 Antibody - middle region: HRP (ARP57792_P050-HRP)
ARP57792_P050-HRP 100 µL

GLRX2 Antibody - middle region: HRP (ARP57792_P050-HRP)

Ask
View Details
DDB1 (C-2):m-IgG Fc BP-HRP Bundle
sc-537406 1 Kit

DDB1 (C-2):m-IgG Fc BP-HRP Bundle

Ask
View Details
MAN2B2 Antibody, Biotin conjugated
A71954-50UG 50 µg

MAN2B2 Antibody, Biotin conjugated

Ask
View Details
MEK1/2 Antibody
E18-6384-1 50μg/50μl

MEK1/2 Antibody

Ask
View Details
Human IL-18 R alpha/IL-1 R5 Alexa Fluor 647 Antibody
FAB840R-100UG 100 µg

Human IL-18 R alpha/IL-1 R5 Alexa Fluor 647 Antibody

Ask
View Details
Recombinant Escherichia coli O6 Uncharacterized protein YhcN (yhcN)
MBS1001455-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 Uncharacterized protein YhcN (yhcN)

Ask
View Details