SARS-CoV-2 Spike RBD 395-430 peptide
SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD) . SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 395-430 (Biotin-LC) peptide
Product Specifications
Sequence
VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT
Peptide Number
SB091
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items