Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin A

Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria. Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains. Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines. Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.

Product Specifications

Sequence

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Peptide Number

SB009

CAS Number

80451-04-3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Prss40 siRNA Oligos set (Mouse)
37856174 3 x 5 nmol

Prss40 siRNA Oligos set (Mouse)

Ask
View Details
Ctns Mouse qPCR Template Standard (NM_031251)
MK203053 1 Kit

Ctns Mouse qPCR Template Standard (NM_031251)

Ask
View Details
ERBB4 Blocking Peptide (C-term)
MBS9229777-01 0.5 mg

ERBB4 Blocking Peptide (C-term)

Ask
View Details
ERBB4 Blocking Peptide (C-term)
MBS9229777-02 5x 0.5 mg

ERBB4 Blocking Peptide (C-term)

Ask
View Details
Human SGSH Recombinant Protein
PPT-15238 100 µg

Human SGSH Recombinant Protein

Ask
View Details
Irisin
100-154 10 µg

Irisin

Ask
View Details