Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin A

Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria. Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains. Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines. Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.

Product Specifications

CAS Number

80451-04-3

Sequence

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Peptide Number

SB009

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Aqp5 shRNA (UAS) - Lentiviral mouse Aqp5 shRNA (UAS, RFP) plasmid
GTR15182869 1 Vial

Lentiviral mouse Aqp5 shRNA (UAS) - Lentiviral mouse Aqp5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
HK2 Antibody
orb841297 2 mg

HK2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (OX-1) [Alexa Fluor 647]
NB100-64895AF647 0.25 mL

Mouse Monoclonal CD45 Antibody (OX-1) [Alexa Fluor 647]

Sign In for Pricing
View Details
Sheep Polyclonal FITC Antibody [Biotin]
NB100-64619 1 mL

Sheep Polyclonal FITC Antibody [Biotin]

Sign In for Pricing
View Details
Mouse Col17a1/Collagen alpha-1 (XVII) chain ELISA Kit
E0304Mo 96 Tests

Mouse Col17a1/Collagen alpha-1 (XVII) chain ELISA Kit

Sign In for Pricing
View Details
Olr1315 3'UTR GFP Stable Cell Line
TU264625 1.0 mL

Olr1315 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details