Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathelicidin antimicrobial peptide 18

LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes. LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation. LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Product Specifications

Product Name Alternative

CAP18, LL-37

Sequence

[LL-37, 37 aa]

Peptide Number

SB004

CAS Number

154947-66-7

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-01 48 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Ask
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-02 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Ask
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-03 5x 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Ask
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-04 10x 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Ask
View Details
Claritas PPT Grade Iridium for ICP-MS 1 ug/mL (1 PPM) 125mL in 2% HCl
CLIR1-1BY 125 mL

Claritas PPT Grade Iridium for ICP-MS 1 ug/mL (1 PPM) 125mL in 2% HCl

Ask
View Details
Psip1 Mouse Gene Knockout Kit (CRISPR)
KN514087 1 Kit

Psip1 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details