Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human beta-defensin-2 peptide

Human beta-defensin-2 (hBD-2), also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis. hBD-2 is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL) . Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils. hBD-2 has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders.

Product Specifications

Product Name Alternative

HBD-2

Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Peptide Number

SB002

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KIR3DL3 Antibody
CSB-PA005287-01 50 µg

KIR3DL3 Antibody

Ask
View Details
KIR3DL3 Antibody
CSB-PA005287-02 100 µg

KIR3DL3 Antibody

Ask
View Details
Olr454 siRNA Oligos set (Rat)
34419176 3 x 5 nmol

Olr454 siRNA Oligos set (Rat)

Ask
View Details
Rat pituitary adenylate cyclase activating polypeptide (PACAP) ELISA kit
EIA06165r 96 Well

Rat pituitary adenylate cyclase activating polypeptide (PACAP) ELISA kit

Ask
View Details
Microbiological Spreaders
M5451 100 Units/Pack

Microbiological Spreaders

Ask
View Details
2,3,7,8,12,13,17,18-Octaethyl-21H,23H-Porphine
OR1009972-01 100 mg

2,3,7,8,12,13,17,18-Octaethyl-21H,23H-Porphine

Ask
View Details